Identification of the growth hormone-releasing hormone analogue [Pro1, Val14]-hGHRH with an incomplete C-term amidation in a confiscated product.

نویسندگان

  • Simone Esposito
  • Koen Deventer
  • Peter Van Eenoo
چکیده

In this work, a modified version of the 44 amino acid human growth hormone-releasing hormone (hGHRH(1-44)) containing an N-terminal proline extension, a valine residue in position 14, and a C-terminus amidation (sequence: PYADAIFTNSYRKVVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 ) has been identified in a confiscated product by liquid chromatography-high resolution mass spectrometry (LC-HRMS). Investigation of the product suggests also an incomplete C-term amidation. Similarly to other hGHRH analogues, available in black markets, this peptide can potentially be used as performance-enhancing drug due to its growth hormone releasing activity and therefore it should be considered as a prohibited substance in sport. Additionally, the presence of partially amidated molecule reveals the poor pharmaceutical quality of the preparation, an aspect which represents a big concern for public health as well.

برای دانلود رایگان متن کامل این مقاله و بیش از 32 میلیون مقاله دیگر ابتدا ثبت نام کنید

ثبت نام

اگر عضو سایت هستید لطفا وارد حساب کاربری خود شوید

منابع مشابه

Plasma disappearance half-time and metabolic clearance rate of exogenous human growth hormone-releasing hormone-(1-44)-NH2 in normal subjects.

By means of human growth hormone-releasing hormone (hGHRH)-RIA using an antiserum directed toward the C-terminal region of hGHRH-(1-44)-NH2, the plasma disappearance half-time and metabolic clearance rate (MCR) of immuoreactive hGHRH (IR-hGHRH) were examined in normal subjects after an iv bolus injection of synthetic hGHRH-(1-44)-NH2 (1 microgram/kg BW). The disappearance of IR-hGHRH from plasm...

متن کامل

TREATMENT OF PRECOCIOUS PUBERTY BY A LONG-ACTING GONADOTROPIN-RELEASING HORMONE ANALOGUE IN CHILDREN

The GnRH analogue has been shown to be effective in the treatment of precocious puberty when given as a daily subcutaneous injection. We studied the effectiveness of a long-acting GnRH analogue, Triptoreline, for the treatment of central precocity, by suppressing gonadotropin and estradiol secretion in three children with true precocious puberty. One month after single dose intramuscular i...

متن کامل

The effect of administration of gonadotropin releasing hormone analogue at estrus or during luteal phase on reproductive performance of dairy cows maintained under sub-temperate climate

Overall, 531 dairy cows were inseminated with the aim to study their reproductive performance following administration of GnRH analogue on different days of estrous cycle with different doses. These cows were divided into six treatment and one control group. Depending upon different treatment groups, Buserelin acetate was injected at a dose of 10.5 µg or 21.0 µg on different days (0, 5 or 12) o...

متن کامل

Increased activity of antagonists of growth

Antagonists of human growth hormone-releasing hormone (hGHRH) with increased potency and improved enzymatic and chemical stability are needed for potential clinical applications. We synthesized 21 antagonistic analogs of hGHRH(1–29)NH2, substituted at positions 8, 9, and 10 of the common core sequence {phenylacetyl-Tyr1, D-Arg2,28, para-chloro-phenylalanine 6, Arg9 homoarginine 9, Tyr10 O-methy...

متن کامل

ذخیره در منابع من


  با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید

عنوان ژورنال:
  • Drug testing and analysis

دوره 6 11-12  شماره 

صفحات  -

تاریخ انتشار 2014